SCOP 1.73: Domain d1xpud1: 1xpu D:1-47

Lineage for d1xpud1 (1xpu D:1-47)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.140: LEM/SAP HeH motif [63450] (5 superfamilies)
   helix-extended loop-helix; parallel helices

4. Superfamily a.140.3: Rho termination factor, N-terminal domain [68912] (1 family)

5. Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein)

6. Protein Rho termination factor, N-terminal domain [68914] (1 species)

7. Species Escherichia coli [TaxId:562] [50295] (9 PDB entries)

8. Domain d1xpud1: 1xpu D:1-47 [115799]
   Other proteins in same PDB: d1xpua2, d1xpua3, d1xpub2, d1xpub3, d1xpuc2, d1xpuc3, d1xpud2, d1xpud3, d1xpue2, d1xpue3, d1xpuf2, d1xpuf3

Details for d1xpud1

PDB Entry: 1xpu, 3.05 Å

PDB Description: Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic 5a-(3-formylphenylsulfanyl)-dihydrobicyclomycin (FPDB)

PDB Compounds: (D:) Rho transcription termination factor

SCOP Domain Sequences for d1xpud1:

Sequence; same for both SEQRES and ATOM records:

>d1xpud1 a.140.3.1 (D:1-47) Rho termination factor, N-terminal domain {Escherichia coli [TaxId: 562]}
mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge

Timeline for d1xpud1:

• d1xpud1 first appeared in SCOP 1.71
  
• d1xpud1 appears in SCOP 1.75
  
• d1xpud1 appears in the current release, SCOPe 2.08