Lineage for d1xpud1 (1xpu D:1-47)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 545076Fold a.140: LEM/SAP HeH motif [63450] (5 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 545107Superfamily a.140.3: Rho termination factor, N-terminal domain [68912] (1 family) (S)
  5. 545108Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein)
  6. 545109Protein Rho termination factor, N-terminal domain [68914] (1 species)
  7. 545110Species Escherichia coli [TaxId:562] [50295] (8 PDB entries)
  8. 545120Domain d1xpud1: 1xpu D:1-47 [115799]
    Other proteins in same PDB: d1xpua2, d1xpua3, d1xpub2, d1xpub3, d1xpuc2, d1xpuc3, d1xpud2, d1xpud3, d1xpue2, d1xpue3, d1xpuf2, d1xpuf3

Details for d1xpud1

PDB Entry: 1xpu (more details), 3.05 Å

PDB Description: Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic 5a-(3-formylphenylsulfanyl)-dihydrobicyclomycin (FPDB)
PDB Compounds: (D:)

SCOP Domain Sequences for d1xpud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xpud1 a.140.3.1 (D:1-47) Rho termination factor, N-terminal domain {Escherichia coli}
mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge

SCOP Domain Coordinates for d1xpud1:

Click to download the PDB-style file with coordinates for d1xpud1.
(The format of our PDB-style files is described here.)

Timeline for d1xpud1: