| Class b: All beta proteins [48724] (178 folds) |
| Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
| Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins) barrel, closed; n=5, S=8 |
| Protein Rho termination factor, RNA-binding domain [68910] (1 species) |
| Species Escherichia coli [TaxId:562] [68911] (9 PDB entries) Uniprot P03002 |
| Domain d1xpub2: 1xpu B:48-126 [115794] Other proteins in same PDB: d1xpua1, d1xpua3, d1xpub1, d1xpub3, d1xpuc1, d1xpuc3, d1xpud1, d1xpud3, d1xpue1, d1xpue3, d1xpuf1, d1xpuf3 protein/RNA complex; complexed with ags, fpd, mg |
PDB Entry: 1xpu (more details), 3.05 Å
SCOPe Domain Sequences for d1xpub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xpub2 b.40.4.5 (B:48-126) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]}
difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg
eryfallkvnevnfdkpen
Timeline for d1xpub2: