Class a: All alpha proteins [46456] (285 folds) |
Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies) helix-extended loop-helix; parallel helices |
Superfamily a.140.3: Rho N-terminal domain-like [68912] (2 families) |
Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein) automatically mapped to Pfam PF07498 |
Protein Rho termination factor, N-terminal domain [68914] (1 species) |
Species Escherichia coli [TaxId:562] [50295] (9 PDB entries) Uniprot P03002 |
Domain d1xpub1: 1xpu B:1-47 [115793] Other proteins in same PDB: d1xpua2, d1xpua3, d1xpub2, d1xpub3, d1xpuc2, d1xpuc3, d1xpud2, d1xpud3, d1xpue2, d1xpue3, d1xpuf2, d1xpuf3 protein/RNA complex; complexed with ags, fpd, mg |
PDB Entry: 1xpu (more details), 3.05 Å
SCOPe Domain Sequences for d1xpub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xpub1 a.140.3.1 (B:1-47) Rho termination factor, N-terminal domain {Escherichia coli [TaxId: 562]} mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge
Timeline for d1xpub1: