Lineage for d1xprf1 (1xpr F:1-47)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1506479Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 1506522Superfamily a.140.3: Rho N-terminal domain-like [68912] (2 families) (S)
  5. 1506523Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein)
    automatically mapped to Pfam PF07498
  6. 1506524Protein Rho termination factor, N-terminal domain [68914] (1 species)
  7. 1506525Species Escherichia coli [TaxId:562] [50295] (9 PDB entries)
    Uniprot P03002
  8. 1506548Domain d1xprf1: 1xpr F:1-47 [115787]
    Other proteins in same PDB: d1xpra2, d1xpra3, d1xprb2, d1xprb3, d1xprc2, d1xprc3, d1xprd2, d1xprd3, d1xpre2, d1xpre3, d1xprf2, d1xprf3
    protein/RNA complex; complexed with ags, fb, mg

Details for d1xprf1

PDB Entry: 1xpr (more details), 3.15 Å

PDB Description: Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic 5a-formylbicyclomycin (FB)
PDB Compounds: (F:) Rho transcription termination factor

SCOPe Domain Sequences for d1xprf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xprf1 a.140.3.1 (F:1-47) Rho termination factor, N-terminal domain {Escherichia coli [TaxId: 562]}
mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge

SCOPe Domain Coordinates for d1xprf1:

Click to download the PDB-style file with coordinates for d1xprf1.
(The format of our PDB-style files is described here.)

Timeline for d1xprf1: