Lineage for d1xpre2 (1xpr E:48-126)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668013Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) (S)
  5. 668307Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
    barrel, closed; n=5, S=8
  6. 668444Protein Rho termination factor, RNA-binding domain [68910] (1 species)
  7. 668445Species Escherichia coli [TaxId:562] [68911] (9 PDB entries)
  8. 668474Domain d1xpre2: 1xpr E:48-126 [115785]
    Other proteins in same PDB: d1xpra1, d1xpra3, d1xprb1, d1xprb3, d1xprc1, d1xprc3, d1xprd1, d1xprd3, d1xpre1, d1xpre3, d1xprf1, d1xprf3

Details for d1xpre2

PDB Entry: 1xpr (more details), 3.15 Å

PDB Description: Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic 5a-formylbicyclomycin (FB)
PDB Compounds: (E:) Rho transcription termination factor

SCOP Domain Sequences for d1xpre2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xpre2 b.40.4.5 (E:48-126) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]}
difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg
eryfallkvnevnfdkpen

SCOP Domain Coordinates for d1xpre2:

Click to download the PDB-style file with coordinates for d1xpre2.
(The format of our PDB-style files is described here.)

Timeline for d1xpre2: