Lineage for d1xprc1 (1xpr C:1-47)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347594Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 2347643Superfamily a.140.3: Rho N-terminal domain-like [68912] (2 families) (S)
  5. 2347644Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein)
    automatically mapped to Pfam PF07498
  6. 2347645Protein Rho termination factor, N-terminal domain [68914] (1 species)
  7. 2347646Species Escherichia coli [TaxId:562] [50295] (9 PDB entries)
    Uniprot P03002
  8. 2347666Domain d1xprc1: 1xpr C:1-47 [115778]
    Other proteins in same PDB: d1xpra2, d1xpra3, d1xprb2, d1xprb3, d1xprc2, d1xprc3, d1xprd2, d1xprd3, d1xpre2, d1xpre3, d1xprf2, d1xprf3
    protein/RNA complex; complexed with ags, fb, mg

Details for d1xprc1

PDB Entry: 1xpr (more details), 3.15 Å

PDB Description: Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic 5a-formylbicyclomycin (FB)
PDB Compounds: (C:) Rho transcription termination factor

SCOPe Domain Sequences for d1xprc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xprc1 a.140.3.1 (C:1-47) Rho termination factor, N-terminal domain {Escherichia coli [TaxId: 562]}
mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge

SCOPe Domain Coordinates for d1xprc1:

Click to download the PDB-style file with coordinates for d1xprc1.
(The format of our PDB-style files is described here.)

Timeline for d1xprc1: