Class a: All alpha proteins [46456] (289 folds) |
Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies) helix-extended loop-helix; parallel helices |
Superfamily a.140.3: Rho N-terminal domain-like [68912] (2 families) |
Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein) automatically mapped to Pfam PF07498 |
Protein Rho termination factor, N-terminal domain [68914] (1 species) |
Species Escherichia coli [TaxId:562] [50295] (9 PDB entries) Uniprot P03002 |
Domain d1xprc1: 1xpr C:1-47 [115778] Other proteins in same PDB: d1xpra2, d1xpra3, d1xprb2, d1xprb3, d1xprc2, d1xprc3, d1xprd2, d1xprd3, d1xpre2, d1xpre3, d1xprf2, d1xprf3 protein/RNA complex; complexed with ags, fb, mg |
PDB Entry: 1xpr (more details), 3.15 Å
SCOPe Domain Sequences for d1xprc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xprc1 a.140.3.1 (C:1-47) Rho termination factor, N-terminal domain {Escherichia coli [TaxId: 562]} mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge
Timeline for d1xprc1: