Lineage for d1xppd_ (1xpp D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2524493Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2524624Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2524732Family d.74.3.2: RBP11/RpoL [64311] (4 proteins)
  6. 2524733Protein DNA-directed RNA polymerase subunit L, RpoL [118020] (1 species)
  7. 2524734Species Thermoplasma acidophilum [TaxId:2303] [118021] (1 PDB entry)
    Uniprot Q9HIC5
  8. 2524738Domain d1xppd_: 1xpp D: [115771]
    Structural genomics target
    complexed with acy, fmt, scn

Details for d1xppd_

PDB Entry: 1xpp (more details), 1.6 Å

PDB Description: Crystal Structure of TA1416,DNA-directed RNA polymerase subunit L, from Thermoplasma acidophilum
PDB Compounds: (D:) DNA-directed RNA polymerase subunit L

SCOPe Domain Sequences for d1xppd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xppd_ d.74.3.2 (D:) DNA-directed RNA polymerase subunit L, RpoL {Thermoplasma acidophilum [TaxId: 2303]}
aesslrviskeknsitveminydntllrtlveeilkddqvdearyyikhpvidnpqiyvr
vksgkpqsaikravrklsklyedlgtqfqkefqryesdhmi

SCOPe Domain Coordinates for d1xppd_:

Click to download the PDB-style file with coordinates for d1xppd_.
(The format of our PDB-style files is described here.)

Timeline for d1xppd_: