Lineage for d1xppb_ (1xpp B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1656918Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1657041Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 1657142Family d.74.3.2: RBP11/RpoL [64311] (3 proteins)
  6. 1657143Protein DNA-directed RNA polymerase subunit L, RpoL [118020] (1 species)
  7. 1657144Species Thermoplasma acidophilum [TaxId:2303] [118021] (1 PDB entry)
    Uniprot Q9HIC5
  8. 1657146Domain d1xppb_: 1xpp B: [115769]
    Structural genomics target
    complexed with acy, fmt, scn

Details for d1xppb_

PDB Entry: 1xpp (more details), 1.6 Å

PDB Description: Crystal Structure of TA1416,DNA-directed RNA polymerase subunit L, from Thermoplasma acidophilum
PDB Compounds: (B:) DNA-directed RNA polymerase subunit L

SCOPe Domain Sequences for d1xppb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xppb_ d.74.3.2 (B:) DNA-directed RNA polymerase subunit L, RpoL {Thermoplasma acidophilum [TaxId: 2303]}
esslrviskeknsitveminydntllrtlveeilkddqvdearyyikhpvidnpqiyvrv
ksgkpqsaikravrklsklyedlgtqfqkefqryesdh

SCOPe Domain Coordinates for d1xppb_:

Click to download the PDB-style file with coordinates for d1xppb_.
(The format of our PDB-style files is described here.)

Timeline for d1xppb_: