Lineage for d1xppa_ (1xpp A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726910Fold d.74: DCoH-like [55247] (4 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 726990Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
    form homo and heterodimers
  5. 727071Family d.74.3.2: RBP11/RpoL [64311] (2 proteins)
  6. 727072Protein DNA-directed RNA polymerase subunit L, RpoL [118020] (1 species)
  7. 727073Species Thermoplasma acidophilum [TaxId:2303] [118021] (1 PDB entry)
  8. 727074Domain d1xppa_: 1xpp A: [115768]

Details for d1xppa_

PDB Entry: 1xpp (more details), 1.6 Å

PDB Description: Crystal Structure of TA1416,DNA-directed RNA polymerase subunit L, from Thermoplasma acidophilum
PDB Compounds: (A:) DNA-directed RNA polymerase subunit L

SCOP Domain Sequences for d1xppa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xppa_ d.74.3.2 (A:) DNA-directed RNA polymerase subunit L, RpoL {Thermoplasma acidophilum [TaxId: 2303]}
aesslrviskeknsitveminydntllrtlveeilkddqvdearyyikhpvidnpqiyvr
vksgkpqsaikravrklsklyedlgtqfqkefqryesdh

SCOP Domain Coordinates for d1xppa_:

Click to download the PDB-style file with coordinates for d1xppa_.
(The format of our PDB-style files is described here.)

Timeline for d1xppa_: