Lineage for d1xppa_ (1xpp A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. Family d.74.3.2: RBP11/RpoL [64311] (4 proteins)
  6. Protein DNA-directed RNA polymerase subunit L, RpoL [118020] (1 species)
  7. Species Thermoplasma acidophilum [TaxId:2303] [118021] (1 PDB entry)
    Uniprot Q9HIC5
  8. Domain d1xppa_: 1xpp A: [115768]
    Structural genomics target
    complexed with acy, fmt, scn

Details for d1xppa_

PDB Entry: 1xpp (more details), 1.6 Å

PDB Description: Crystal Structure of TA1416,DNA-directed RNA polymerase subunit L, from Thermoplasma acidophilum
PDB Compounds: (A:) DNA-directed RNA polymerase subunit L

SCOPe Domain Sequences for d1xppa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xppa_ d.74.3.2 (A:) DNA-directed RNA polymerase subunit L, RpoL {Thermoplasma acidophilum [TaxId: 2303]}
aesslrviskeknsitveminydntllrtlveeilkddqvdearyyikhpvidnpqiyvr
vksgkpqsaikravrklsklyedlgtqfqkefqryesdh

SCOPe Domain Coordinates for d1xppa_ are not available.

Timeline for d1xppa_:

Domains from other chains:
(mouse over for more information)
d1xppb_, d1xppc_, d1xppd_