Lineage for d1xpna_ (1xpn A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 552997Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 553554Superfamily b.3.7: Hypothetical protein PA1324 [117074] (1 family) (S)
  5. 553555Family b.3.7.1: Hypothetical protein PA1324 [117075] (1 protein)
  6. 553556Protein Hypothetical protein PA1324 [117076] (1 species)
  7. 553557Species Pseudomonas aeruginosa [TaxId:287] [117077] (1 PDB entry)
  8. 553558Domain d1xpna_: 1xpn A: [115767]
    Structural genomics target

Details for d1xpna_

PDB Entry: 1xpn (more details)

PDB Description: NMR structure of P. aeruginosa protein PA1324: Northeast Structural Genomics Consortium target PaP1

SCOP Domain Sequences for d1xpna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xpna_ b.3.7.1 (A:) Hypothetical protein PA1324 {Pseudomonas aeruginosa}
gsshhhhhhssglvprgshmasnpndlpdfpeheyaatqqvgggvingdlyltsasgaiq
kgtntkvalepatsymkayyakfgnldaakrdpdvqppvldprratyvreattdqngrfd
fdhipngtyyisseltwsaqsdgktiteggtvtklvtvsgsqpqkvlltr

SCOP Domain Coordinates for d1xpna_:

Click to download the PDB-style file with coordinates for d1xpna_.
(The format of our PDB-style files is described here.)

Timeline for d1xpna_: