SCOPe 2.08: Domain d1xpna1: 1xpn A:21-170

Lineage for d1xpna1 (1xpn A:21-170)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.7: Hypothetical protein PA1324 [117074] (1 family)

5. Family b.3.7.1: Hypothetical protein PA1324 [117075] (1 protein)

6. Protein Hypothetical protein PA1324 [117076] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [117077] (1 PDB entry)
   Uniprot Q9I420 21-170

8. Domain d1xpna1: 1xpn A:21-170 [115767]
   Other proteins in same PDB: d1xpna2
   Structural genomics target

Details for d1xpna1

PDB Entry: 1xpn

PDB Description: NMR structure of P. aeruginosa protein PA1324: Northeast Structural Genomics Consortium target PaP1

PDB Compounds: (A:) hypothetical protein PA1324

SCOPe Domain Sequences for d1xpna1:

Sequence; same for both SEQRES and ATOM records:

>d1xpna1 b.3.7.1 (A:21-170) Hypothetical protein PA1324 {Pseudomonas aeruginosa [TaxId: 287]}
asnpndlpdfpeheyaatqqvgggvingdlyltsasgaiqkgtntkvalepatsymkayy
akfgnldaakrdpdvqppvldprratyvreattdqngrfdfdhipngtyyisseltwsaq
sdgktiteggtvtklvtvsgsqpqkvlltr

Timeline for d1xpna1:

• d1xpna1 first appeared in SCOP 1.71, called d1xpna_
  
• d1xpna1 appears in SCOPe 2.07