SCOPe 2.05: Domain d1xpld2: 1xpl D:168-388

Lineage for d1xpld2 (1xpl D:168-388)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)

6. Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS [110760] (2 species)
   most similar to FabH

7. Species Staphylococcus aureus [TaxId:1280] [110761] (5 PDB entries)
   Uniprot Q7A3F6

8. Domain d1xpld2: 1xpl D:168-388 [115758]
   complexed with caa, so4

Details for d1xpld2

PDB Entry: 1xpl, 2 Å

PDB Description: crystal structure of staphylococcus aureus hmg-coa synthase with acetoacetyl-coa and acetylated cysteine

PDB Compounds: (D:) 3-hydroxy-3-methylglutaryl CoA synthase

SCOPe Domain Sequences for d1xpld2:

Sequence; same for both SEQRES and ATOM records:

>d1xpld2 c.95.1.2 (D:168-388) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus [TaxId: 1280]}
ilalnedavaytedvydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladf
aslcfhvpftkmgkkalesiidnadettqerlrsgyedavdynryvgniytgslylslis
llenrdlqagetiglfsygsgsvgefysatlvegykdhldqaahkallnnrtevsvdaye
tffkrfddvefdeeqdavhedrhifylsniennvreyhrpe

Timeline for d1xpld2:

• d1xpld2 first appeared in SCOP 1.71
  
• d1xpld2 appears in SCOPe 2.04
  
• d1xpld2 appears in SCOPe 2.06
  
• d1xpld2 appears in the current release, SCOPe 2.08