![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins) |
![]() | Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS, C-terminal domain [419029] (2 species) most similar to FabH |
![]() | Domain d1xpld2: 1xpl D:168-388 [115758] Other proteins in same PDB: d1xpla1, d1xpla3, d1xpla4, d1xplb1, d1xplb3, d1xplb4, d1xplc1, d1xplc3, d1xplc4, d1xpld1, d1xpld3, d1xpld4 complexed with caa, so4 has additional subdomain(s) that are not in the common domain |
PDB Entry: 1xpl (more details), 2 Å
SCOPe Domain Sequences for d1xpld2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xpld2 c.95.1.2 (D:168-388) 3-hydroxy-3-methylglutaryl CoA synthase MvaS, C-terminal domain {Staphylococcus aureus [TaxId: 1280]} ilalnedavaytedvydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladf aslcfhvpftkmgkkalesiidnadettqerlrsgyedavdynryvgniytgslylslis llenrdlqagetiglfsygsgsvgefysatlvegykdhldqaahkallnnrtevsvdaye tffkrfddvefdeeqdavhedrhifylsniennvreyhrpe
Timeline for d1xpld2: