SCOP 1.71: Domain d1xpla1: 1xpl A:2-167

Lineage for d1xpla1 (1xpl A:2-167)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins)

6. Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS [110760] (1 species)
   most similar to FabH

7. Species Staphylococcus aureus [TaxId:1280] [110761] (5 PDB entries)

8. Domain d1xpla1: 1xpl A:2-167 [115751]

Details for d1xpla1

PDB Entry: 1xpl, 2 Å

PDB Description: crystal structure of staphylococcus aureus hmg-coa synthase with acetoacetyl-coa and acetylated cysteine

SCOP Domain Sequences for d1xpla1:

Sequence; same for both SEQRES and ATOM records:

>d1xpla1 c.95.1.2 (A:2-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus}
aigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakd
iitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiqla
kdylatrpnekvlviatdtaryglnsggeptqgagavamviahnps

Timeline for d1xpla1:

• d1xpla1 is new in SCOP 1.71
  
• d1xpla1 appears in SCOP 1.73
  
• d1xpla1 appears in the current release, SCOPe 2.08