![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins) |
![]() | Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS, N-terminal domain [419028] (2 species) most similar to FabH |
![]() | Species Staphylococcus aureus [TaxId:1280] [419512] (5 PDB entries) Uniprot Q7A3F6 |
![]() | Domain d1xpla1: 1xpl A:3-167 [115751] Other proteins in same PDB: d1xpla2, d1xpla3, d1xpla4, d1xplb2, d1xplb3, d1xplb4, d1xplc2, d1xplc3, d1xplc4, d1xpld2, d1xpld3, d1xpld4 complexed with caa, so4 |
PDB Entry: 1xpl (more details), 2 Å
SCOPe Domain Sequences for d1xpla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xpla1 c.95.1.2 (A:3-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS, N-terminal domain {Staphylococcus aureus [TaxId: 1280]} igidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakdi itdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiqlak dylatrpnekvlviatdtaryglnsggeptqgagavamviahnps
Timeline for d1xpla1: