![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins) |
![]() | Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS, N-terminal domain [419028] (2 species) most similar to FabH |
![]() | Species Staphylococcus aureus [TaxId:1280] [419512] (5 PDB entries) Uniprot Q7A3F6 |
![]() | Domain d1xpkd1: 1xpk D:2-167 [115749] Other proteins in same PDB: d1xpka2, d1xpkb2, d1xpkc2, d1xpkd2 complexed with caa, hmg, so4 |
PDB Entry: 1xpk (more details), 2 Å
SCOPe Domain Sequences for d1xpkd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xpkd1 c.95.1.2 (D:2-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS, N-terminal domain {Staphylococcus aureus [TaxId: 1280]} tigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakd iitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiqla kdylatrpnekvlviatdtaryglnsggeptqgagavamviahnps
Timeline for d1xpkd1: