Lineage for d1xpkc1 (1xpk C:2-167)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 593921Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 593922Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 594204Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins)
  6. 594205Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS [110760] (1 species)
    most similar to FabH
  7. 594206Species Staphylococcus aureus [TaxId:1280] [110761] (5 PDB entries)
  8. 594221Domain d1xpkc1: 1xpk C:2-167 [115747]

Details for d1xpkc1

PDB Entry: 1xpk (more details), 2 Å

PDB Description: crystal structure of staphylococcus aureus hmg-coa synthase with hmg- coa and with acetoacetyl-coa and acetylated cysteine

SCOP Domain Sequences for d1xpkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xpkc1 c.95.1.2 (C:2-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus}
tigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakd
iitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiqla
kdylatrpnekvlviatdtaryglnsggeptqgagavamviahnps

SCOP Domain Coordinates for d1xpkc1:

Click to download the PDB-style file with coordinates for d1xpkc1.
(The format of our PDB-style files is described here.)

Timeline for d1xpkc1: