Lineage for d1xpjb_ (1xpj B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1883149Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1883150Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1883748Family c.108.1.18: Hypothetical protein VC0232 [117512] (1 protein)
    contains a deletion in the common fold; segment-swapped tetramer
  6. 1883749Protein Hypothetical protein VC0232 [117513] (1 species)
  7. 1883750Species Vibrio cholerae [TaxId:666] [117514] (1 PDB entry)
    Uniprot Q9KVB4
  8. 1883752Domain d1xpjb_: 1xpj B: [115740]
    Structural genomics target
    complexed with hg, tla

Details for d1xpjb_

PDB Entry: 1xpj (more details), 2.3 Å

PDB Description: crystal structure of mcsg target apc26283 from vibrio cholerae
PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d1xpjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xpjb_ c.108.1.18 (B:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]}
mkklivdldgtltqantsdyrnvlprldvieqlreyhqlgfeivistarnmrtyegnvgk
inihtlpiitewldkhqvpydeilvgkpwcghdgfyiddravrpsefasmnleeihqlfe
kek

SCOPe Domain Coordinates for d1xpjb_:

Click to download the PDB-style file with coordinates for d1xpjb_.
(The format of our PDB-style files is described here.)

Timeline for d1xpjb_: