Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (23 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.18: Hypothetical protein VC0232 [117512] (1 protein) contains a deletion in the common fold; segment-swapped tetramer |
Protein Hypothetical protein VC0232 [117513] (1 species) |
Species Vibrio cholerae [TaxId:666] [117514] (1 PDB entry) |
Domain d1xpja_: 1xpj A: [115739] |
PDB Entry: 1xpj (more details), 2.3 Å
SCOP Domain Sequences for d1xpja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} mkklivdldgtltqantsdyrnvlprldvieqlreyhqlgfeivistarnmrtyegnvgk inihtlpiitewldkhqvpydeilvgkpwcghdgfyiddravrpsefasmnleeihqlfe keks
Timeline for d1xpja_: