SCOP 1.73: Domain d1xpja_: 1xpj A:

Lineage for d1xpja_ (1xpj A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (23 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.18: Hypothetical protein VC0232 [117512] (1 protein)
   contains a deletion in the common fold; segment-swapped tetramer

6. Protein Hypothetical protein VC0232 [117513] (1 species)

7. Species Vibrio cholerae [TaxId:666] [117514] (1 PDB entry)

8. Domain d1xpja_: 1xpj A: [115739]

Details for d1xpja_

PDB Entry: 1xpj, 2.3 Å

PDB Description: crystal structure of mcsg target apc26283 from vibrio cholerae

PDB Compounds: (A:) hypothetical protein

SCOP Domain Sequences for d1xpja_:

Sequence; same for both SEQRES and ATOM records:

>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]}
mkklivdldgtltqantsdyrnvlprldvieqlreyhqlgfeivistarnmrtyegnvgk
inihtlpiitewldkhqvpydeilvgkpwcghdgfyiddravrpsefasmnleeihqlfe
keks

Timeline for d1xpja_:

• d1xpja_ first appeared in SCOP 1.71
  
• d1xpja_ appears in SCOP 1.75
  
• d1xpja_ appears in the current release, SCOPe 2.08