Lineage for d1xpja_ (1xpj A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 594610Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 594611Superfamily c.108.1: HAD-like [56784] (18 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 594842Family c.108.1.18: Hypothetical protein VC0232 [117512] (1 protein)
    contains a deletion in the common fold; segment-swapped tetramer
  6. 594843Protein Hypothetical protein VC0232 [117513] (1 species)
  7. 594844Species Vibrio cholerae [TaxId:666] [117514] (1 PDB entry)
  8. 594845Domain d1xpja_: 1xpj A: [115739]

Details for d1xpja_

PDB Entry: 1xpj (more details), 2.3 Å

PDB Description: crystal structure of mcsg target apc26283 from vibrio cholerae

SCOP Domain Sequences for d1xpja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae}
mkklivdldgtltqantsdyrnvlprldvieqlreyhqlgfeivistarnmrtyegnvgk
inihtlpiitewldkhqvpydeilvgkpwcghdgfyiddravrpsefasmnleeihqlfe
keks

SCOP Domain Coordinates for d1xpja_:

Click to download the PDB-style file with coordinates for d1xpja_.
(The format of our PDB-style files is described here.)

Timeline for d1xpja_: