Lineage for d1xp9a_ (1xp9 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728396Protein Estrogen receptor alpha [48519] (1 species)
  7. 2728397Species Human (Homo sapiens) [TaxId:9606] [48520] (107 PDB entries)
    Uniprot P03372 307-551
  8. 2728493Domain d1xp9a_: 1xp9 A: [115737]
    complexed with aij

Details for d1xp9a_

PDB Entry: 1xp9 (more details), 1.8 Å

PDB Description: human estrogen receptor alpha ligand-binding domain in complex with compound 18
PDB Compounds: (A:) Estrogen receptor

SCOPe Domain Sequences for d1xp9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xp9a_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
fvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifd
mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemlda
hrlha

SCOPe Domain Coordinates for d1xp9a_:

Click to download the PDB-style file with coordinates for d1xp9a_.
(The format of our PDB-style files is described here.)

Timeline for d1xp9a_: