Lineage for d1xp8a2 (1xp8 A:283-341)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946749Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
    alpha-beta(3)-alpha(2); 2 layers, alpha/beta
  4. 2946750Superfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families) (S)
  5. 2946751Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein)
  6. 2946752Protein RecA protein, C-terminal domain [54754] (5 species)
  7. 2946753Species Deinococcus radiodurans [TaxId:1299] [117900] (1 PDB entry)
    Uniprot P42443 15-341
  8. 2946754Domain d1xp8a2: 1xp8 A:283-341 [115736]
    Other proteins in same PDB: d1xp8a1
    protein/DNA complex; complexed with ags

Details for d1xp8a2

PDB Entry: 1xp8 (more details), 2.5 Å

PDB Description: deinococcus radiodurans reca in complex with atp-gamma-s
PDB Compounds: (A:) reca protein

SCOPe Domain Sequences for d1xp8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xp8a2 d.48.1.1 (A:283-341) RecA protein, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]}
qlsdlvglaadmdiikkagsfysygderigqgkektiayiaerpemeqeirdrvmaair

SCOPe Domain Coordinates for d1xp8a2:

Click to download the PDB-style file with coordinates for d1xp8a2.
(The format of our PDB-style files is described here.)

Timeline for d1xp8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xp8a1