![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies) alpha-beta(3)-alpha(2); 2 layers, alpha/beta |
![]() | Superfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families) ![]() |
![]() | Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein) |
![]() | Protein RecA protein, C-terminal domain [54754] (5 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [117900] (1 PDB entry) Uniprot P42443 15-341 |
![]() | Domain d1xp8a2: 1xp8 A:283-341 [115736] Other proteins in same PDB: d1xp8a1 protein/DNA complex; complexed with ags |
PDB Entry: 1xp8 (more details), 2.5 Å
SCOPe Domain Sequences for d1xp8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xp8a2 d.48.1.1 (A:283-341) RecA protein, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]} qlsdlvglaadmdiikkagsfysygderigqgkektiayiaerpemeqeirdrvmaair
Timeline for d1xp8a2: