Lineage for d1xp8a1 (1xp8 A:15-282)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869423Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2869910Protein RecA protein, ATPase-domain [52671] (6 species)
    C-terminal domain is alpha+beta
  7. 2869911Species Deinococcus radiodurans [TaxId:1299] [117540] (1 PDB entry)
    Uniprot P42443 15-341
  8. 2869912Domain d1xp8a1: 1xp8 A:15-282 [115735]
    Other proteins in same PDB: d1xp8a2
    protein/DNA complex; complexed with ags

Details for d1xp8a1

PDB Entry: 1xp8 (more details), 2.5 Å

PDB Description: deinococcus radiodurans reca in complex with atp-gamma-s
PDB Compounds: (A:) reca protein

SCOPe Domain Sequences for d1xp8a1:

Sequence, based on SEQRES records: (download)

>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]}
akerskaietamsqiekafgkgsimklgaeskldvqvvstgslsldlalgvggiprgrit
eiygpesggkttlalaivaqaqkaggtcafidaehaldpvyaralgvntdellvsqpdng
eqaleimellvrsgaidvvvvdsvaaltpraeiegdmgdslpglqarlmsqalrkltail
sktgtaaifinqvrekigvmygnpetttggralkfyasvrldvrkigqptkvgndavant
vkiktvknkvaapfkevelalvygkgfd

Sequence, based on observed residues (ATOM records): (download)

>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]}
akerskaietamsqiekafgkgsimklgaeskldvqvvstgslsldlalgvggiprgrit
eiygpesggkttlalaivaqaqkaggtcafidaehaldpvyaralgvntdellvsqpdng
eqaleimellvrsgaidvvvvdsvaaltpraeipglqarlmsqalrkltailsktgtaai
finqvggralkfyasvrldvrkigqptvantvkiktvknkvaapfkevelalvygkgfd

SCOPe Domain Coordinates for d1xp8a1:

Click to download the PDB-style file with coordinates for d1xp8a1.
(The format of our PDB-style files is described here.)

Timeline for d1xp8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xp8a2