Lineage for d1xp6a_ (1xp6 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 543419Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 543420Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 543421Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 543453Protein Estrogen receptor alpha [48519] (1 species)
  7. 543454Species Human (Homo sapiens) [TaxId:9606] [48520] (19 PDB entries)
  8. 543456Domain d1xp6a_: 1xp6 A: [115734]
    complexed with aiu

Details for d1xp6a_

PDB Entry: 1xp6 (more details), 1.7 Å

PDB Description: human estrogen receptor alpha ligand-binding domain in complex with compound 16

SCOP Domain Sequences for d1xp6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xp6a_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens)}
alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
fvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifd
mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemlda
hrlha

SCOP Domain Coordinates for d1xp6a_:

Click to download the PDB-style file with coordinates for d1xp6a_.
(The format of our PDB-style files is described here.)

Timeline for d1xp6a_: