Lineage for d1xp5a4 (1xp5 A:1-124,A:240-343,A:751-994)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 620971Fold f.33: Calcium ATPase, transmembrane domain M [81666] (1 superfamily)
    core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains
  4. 620972Superfamily f.33.1: Calcium ATPase, transmembrane domain M [81665] (1 family) (S)
  5. 620973Family f.33.1.1: Calcium ATPase, transmembrane domain M [81664] (1 protein)
  6. 620974Protein Calcium ATPase, transmembrane domain M [81663] (1 species)
    the N-terminal 40 residues interact with /form a part of transduction domain A
  7. 620975Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (9 PDB entries)
  8. 620986Domain d1xp5a4: 1xp5 A:1-124,A:240-343,A:751-994 [115733]
    Other proteins in same PDB: d1xp5a1, d1xp5a2, d1xp5a3
    complexed with alf, k, mg, tg1

Details for d1xp5a4

PDB Entry: 1xp5 (more details), 3 Å

PDB Description: Structure Of The (Sr)Ca2+-ATPase E2-AlF4- Form

SCOP Domain Sequences for d1xp5a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xp5a4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus)}
meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl
lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk
eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy
yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf
irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp
prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh
phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls
mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg

SCOP Domain Coordinates for d1xp5a4:

Click to download the PDB-style file with coordinates for d1xp5a4.
(The format of our PDB-style files is described here.)

Timeline for d1xp5a4: