Lineage for d1xp5a3 (1xp5 A:361-599)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1051353Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily)
    unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432
  4. 1051354Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) (S)
  5. 1051355Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins)
  6. 1051356Protein Calcium ATPase [81658] (1 species)
  7. 1051357Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (14 PDB entries)
    Uniprot P04191
  8. 1051373Domain d1xp5a3: 1xp5 A:361-599 [115732]
    Other proteins in same PDB: d1xp5a1, d1xp5a2, d1xp5a4
    complexed with alf, k, mg, tg1

Details for d1xp5a3

PDB Entry: 1xp5 (more details), 3 Å

PDB Description: Structure Of The (Sr)Ca2+-ATPase E2-AlF4- Form
PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d1xp5a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xp5a3 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc
ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk
keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp
vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm

SCOPe Domain Coordinates for d1xp5a3:

Click to download the PDB-style file with coordinates for d1xp5a3.
(The format of our PDB-style files is described here.)

Timeline for d1xp5a3: