SCOP 1.71: Domain d1xp5a2: 1xp5 A:344-360,A:600-750

Lineage for d1xp5a2 (1xp5 A:344-360,A:600-750)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (18 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.7: Calcium ATPase, catalytic domain P [81656] (1 protein)
   interrupted by a large insertion, domain N

6. Protein Calcium ATPase, catalytic domain P [81655] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81654] (9 PDB entries)

8. Domain d1xp5a2: 1xp5 A:344-360,A:600-750 [115731]
   Other proteins in same PDB: d1xp5a1, d1xp5a3, d1xp5a4
   complexed with alf, k, mg, tg1

Details for d1xp5a2

PDB Entry: 1xp5, 3 Å

PDB Description: Structure Of The (Sr)Ca2+-ATPase E2-AlF4- Form

SCOP Domain Sequences for d1xp5a2:

Sequence; same for both SEQRES and ATOM records:

>d1xp5a2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus)}
ctsvicsdktgtlttnqXldpprkevmgsiqlcrdagirvimitgdnkgtaiaicrrigi
fgeneevadraytgrefddlplaeqreacrraccfarvepshkskiveylqsydeitamt
gdgvndapalkkaeigiamgsgtavaktasemvladdnfstivaaveeg

Timeline for d1xp5a2:

• d1xp5a2 is new in SCOP 1.71
  
• d1xp5a2 appears in SCOP 1.73
  
• d1xp5a2 appears in the current release, SCOPe 2.08