Lineage for d1xp4c2 (1xp4 C:25-293)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 617469Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 617470Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families) (S)
  5. 617471Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (13 proteins)
  6. 617716Protein D,D-carboxypeptidase DacA, N-terminal domain [118181] (1 species)
  7. 617717Species Streptococcus pneumoniae [TaxId:1313] [118182] (1 PDB entry)
  8. 617720Domain d1xp4c2: 1xp4 C:25-293 [115727]
    Other proteins in same PDB: d1xp4a1, d1xp4b1, d1xp4c1, d1xp4d1

Details for d1xp4c2

PDB Entry: 1xp4 (more details), 2.8 Å

PDB Description: Crystal structure of a peptidoglycan synthesis regulatory factor (PBP3) from Streptococcus pneumoniae

SCOP Domain Sequences for d1xp4c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xp4c2 e.3.1.1 (C:25-293) D,D-carboxypeptidase DacA, N-terminal domain {Streptococcus pneumoniae}
ftiaakhaiaveantgkilyekdatqpveiasitklitvylvyealengsitlstpvdis
dypyqlttnseasnipmearnytveelleatlvssansaaialaekiagsekdfvdmmra
kllewgiqdatvvnttglnnetlgdniypgskkdeenklsaydvaivarnlikkypqvle
itkkpsstfagmtitstnymlegmpayrggfdglktgttdkagesfvgttvekgmrvitv
vlnadhqdnnpyarftatsslmdyisstf

SCOP Domain Coordinates for d1xp4c2:

Click to download the PDB-style file with coordinates for d1xp4c2.
(The format of our PDB-style files is described here.)

Timeline for d1xp4c2: