Class b: All beta proteins [48724] (177 folds) |
Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily) sandwich; 6 strands in 2 sheets |
Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families) |
Family b.105.1.1: PBP5 C-terminal domain-like [69190] (2 proteins) automatically mapped to Pfam PF07943 |
Protein D,D-carboxypeptidase DacA, C-terminal domain [117078] (1 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [117079] (1 PDB entry) Uniprot P72518 25-393 |
Domain d1xp4a1: 1xp4 A:294-386 [115722] Other proteins in same PDB: d1xp4a2, d1xp4b2, d1xp4c2, d1xp4d2 complexed with iod, so4 |
PDB Entry: 1xp4 (more details), 2.8 Å
SCOPe Domain Sequences for d1xp4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xp4a1 b.105.1.1 (A:294-386) D,D-carboxypeptidase DacA, C-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} tlrkivqqgdayqdskapvqdgkedtviavapediyliervgnqssqsvqftpdskaipa pleagtvvghltyedkdligqgyitterpsfem
Timeline for d1xp4a1: