SCOP 1.71: Domain d1xp4a1: 1xp4 A:294-386

Lineage for d1xp4a1 (1xp4 A:294-386)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
   sandwich; 6 strands in 2 sheets

4. Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (2 families)

5. Family b.105.1.1: PBP5 C-terminal domain-like [69190] (2 proteins)

6. Protein D,D-carboxypeptidase DacA, C-terminal domain [117078] (1 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [117079] (1 PDB entry)

8. Domain d1xp4a1: 1xp4 A:294-386 [115722]
   Other proteins in same PDB: d1xp4a2, d1xp4b2, d1xp4c2, d1xp4d2

Details for d1xp4a1

PDB Entry: 1xp4, 2.8 Å

PDB Description: Crystal structure of a peptidoglycan synthesis regulatory factor (PBP3) from Streptococcus pneumoniae

SCOP Domain Sequences for d1xp4a1:

Sequence; same for both SEQRES and ATOM records:

>d1xp4a1 b.105.1.1 (A:294-386) D,D-carboxypeptidase DacA, C-terminal domain {Streptococcus pneumoniae}
tlrkivqqgdayqdskapvqdgkedtviavapediyliervgnqssqsvqftpdskaipa
pleagtvvghltyedkdligqgyitterpsfem

Timeline for d1xp4a1:

• d1xp4a1 is new in SCOP 1.71
  
• d1xp4a1 appears in SCOP 1.73
  
• d1xp4a1 appears in the current release, SCOPe 2.08