![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families) ![]() |
![]() | Family a.211.1.2: PDEase [48548] (6 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
![]() | Protein cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx [101439] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101440] (15 PDB entries) Uniprot O76074 534-860 |
![]() | Domain d1xp0a_: 1xp0 A: [115720] complexed with mg, vdn, zn |
PDB Entry: 1xp0 (more details), 1.79 Å
SCOP Domain Sequences for d1xp0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xp0a_ a.211.1.2 (A:) cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx {Human (Homo sapiens) [TaxId: 9606]} eeetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhe vlcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalsh dldhpgvsnqflintnselalmyndesvlehhhfdqclmilnspgnqilsglsieeyktt lkiikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpw piqqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyeal thvsedcfplldgcrknrqkwqalae
Timeline for d1xp0a_: