Lineage for d1xp0a_ (1xp0 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2736712Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2737005Protein cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx [101439] (1 species)
  7. 2737006Species Human (Homo sapiens) [TaxId:9606] [101440] (26 PDB entries)
    Uniprot O76074 534-860
  8. 2737009Domain d1xp0a_: 1xp0 A: [115720]
    complexed with mg, vdn, zn

Details for d1xp0a_

PDB Entry: 1xp0 (more details), 1.79 Å

PDB Description: catalytic domain of human phosphodiesterase 5a in complex with vardenafil
PDB Compounds: (A:) cGMP-specific 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d1xp0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xp0a_ a.211.1.2 (A:) cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx {Human (Homo sapiens) [TaxId: 9606]}
eeetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhe
vlcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalsh
dldhpgvsnqflintnselalmyndesvlehhhfdqclmilnspgnqilsglsieeyktt
lkiikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpw
piqqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyeal
thvsedcfplldgcrknrqkwqalae

SCOPe Domain Coordinates for d1xp0a_:

Click to download the PDB-style file with coordinates for d1xp0a_.
(The format of our PDB-style files is described here.)

Timeline for d1xp0a_: