Lineage for d1xoza_ (1xoz A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 927815Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 927816Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 927893Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 928015Protein cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx [101439] (1 species)
  7. 928016Species Human (Homo sapiens) [TaxId:9606] [101440] (17 PDB entries)
    Uniprot O76074 534-860
  8. 928018Domain d1xoza_: 1xoz A: [115719]
    complexed with cia, mg, zn

Details for d1xoza_

PDB Entry: 1xoz (more details), 1.37 Å

PDB Description: catalytic domain of human phosphodiesterase 5a in complex with tadalafil
PDB Compounds: (A:) cGMP-specific 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d1xoza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xoza_ a.211.1.2 (A:) cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx {Human (Homo sapiens) [TaxId: 9606]}
eeetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhe
vlcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalsh
dldhpgvsnqflintnselalmyndesvlehhhfdqclmilnspgnqilsglsieeyktt
lkiikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpw
piqqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyeal
thvsedcfplldgcrknrqkwqalae

SCOPe Domain Coordinates for d1xoza_:

Click to download the PDB-style file with coordinates for d1xoza_.
(The format of our PDB-style files is described here.)

Timeline for d1xoza_: