SCOPe 2.07: Domain d1xoya1: 1xoy A:2-161

Lineage for d1xoya1 (1xoy A:2-161)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.26: Hypothetical protein AT3g04780/F7O18_27 [117108] (1 protein)
   Pfam PF06201; DUF1000

6. Protein Hypothetical protein AT3g04780/F7O18_27 [117109] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117110] (1 PDB entry)
   Uniprot Q93Z56

8. Domain d1xoya1: 1xoy A:2-161 [115718]
   Other proteins in same PDB: d1xoya2

Details for d1xoya1

PDB Entry: 1xoy

PDB Description: solution structure of at3g04780.1, an arabidopsis ortholog of the c- terminal domain of human thioredoxin-like protein

PDB Compounds: (A:) hypothetical protein At3g04780.1

SCOPe Domain Sequences for d1xoya1:

Sequence; same for both SEQRES and ATOM records:

>d1xoya1 b.18.1.26 (A:2-161) Hypothetical protein AT3g04780/F7O18_27 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
saesasqipkgqvdlldfidwsgveclnqssshslpnalkqgyredeglnlesdadeqll
iyipfnqviklhsfaikgpeeegpktvkffsnkehmcfsnvndfppsdtaelteenlkgk
pvvlkyvkfqnvrsltifieanqsgsevtkvqkialygst

Timeline for d1xoya1:

• d1xoya1 first appeared in SCOP 1.71, called d1xoya_
  
• d1xoya1 appears in SCOPe 2.06
  
• d1xoya1 appears in the current release, SCOPe 2.08