Lineage for d1xoya_ (1xoy A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 554850Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 554851Superfamily b.18.1: Galactose-binding domain-like [49785] (27 families) (S)
  5. 555238Family b.18.1.26: Hypothetical protein AT3g04780/F7O18 27 [117108] (1 protein)
    Pfam 06201; DUF1000
  6. 555239Protein Hypothetical protein AT3g04780/F7O18_27 [117109] (1 species)
  7. 555240Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117110] (1 PDB entry)
  8. 555241Domain d1xoya_: 1xoy A: [115718]

Details for d1xoya_

PDB Entry: 1xoy (more details)

PDB Description: solution structure of at3g04780.1, an arabidopsis ortholog of the c- terminal domain of human thioredoxin-like protein

SCOP Domain Sequences for d1xoya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xoya_ b.18.1.26 (A:) Hypothetical protein AT3g04780/F7O18_27 {Thale cress (Arabidopsis thaliana)}
ssaesasqipkgqvdlldfidwsgveclnqssshslpnalkqgyredeglnlesdadeql
liyipfnqviklhsfaikgpeeegpktvkffsnkehmcfsnvndfppsdtaelteenlkg
kpvvlkyvkfqnvrsltifieanqsgsevtkvqkialygst

SCOP Domain Coordinates for d1xoya_:

Click to download the PDB-style file with coordinates for d1xoya_.
(The format of our PDB-style files is described here.)

Timeline for d1xoya_: