SCOP 1.73: Domain d1xoub_: 1xou B:

Lineage for d1xoub_ (1xou B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.231: EspA/CesA-like [116926] (1 superfamily)
   4 helices; bundle, closed, left ight-handed twist; interlocked (hetero)dimer of 2-helical subunits

4. Superfamily a.231.1: EspA/CesA-like [116927] (2 families)
   secreted protein and its chaperone both adopt similar substructures in the heterodimer

5. Family a.231.1.2: EspA chaperone CesA [116931] (1 protein)

6. Protein EspA chaperone CesA [116932] (1 species)

7. Species Escherichia coli [TaxId:562] [116933] (1 PDB entry)

8. Domain d1xoub_: 1xou B: [115716]
   Other proteins in same PDB: d1xoua_
   mutant

Details for d1xoub_

PDB Entry: 1xou, 2.8 Å

PDB Description: crystal structure of the cesa-espa complex

PDB Compounds: (B:) Z5138 gene product

SCOP Domain Sequences for d1xoub_:

Sequence; same for both SEQRES and ATOM records:

>d1xoub_ a.231.1.2 (B:) EspA chaperone CesA {Escherichia coli [TaxId: 562]}
givsqtrnkelldkkirseieaikkiiaefdvvkesvnelsekaktdpqaaeklnklieg
ytygeerklydsalskieklietl

Timeline for d1xoub_:

• d1xoub_ first appeared in SCOP 1.71
  
• d1xoub_ appears in SCOP 1.75
  
• d1xoub_ appears in the current release, SCOPe 2.08