![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.231: EspA/CesA-like [116926] (1 superfamily) 4 helices; bundle, closed, left ight-handed twist; interlocked (hetero)dimer of 2-helical subunits |
![]() | Superfamily a.231.1: EspA/CesA-like [116927] (2 families) ![]() secreted protein and its chaperone both adopt similar substructures in the heterodimer |
![]() | Family a.231.1.2: EspA chaperone CesA [116931] (1 protein) |
![]() | Protein EspA chaperone CesA [116932] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [116933] (1 PDB entry) |
![]() | Domain d1xoub_: 1xou B: [115716] Other proteins in same PDB: d1xoua_ mutant |
PDB Entry: 1xou (more details), 2.8 Å
SCOP Domain Sequences for d1xoub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xoub_ a.231.1.2 (B:) EspA chaperone CesA {Escherichia coli} givsqtrnkelldkkirseieaikkiiaefdvvkesvnelsekaktdpqaaeklnklieg ytygeerklydsalskieklietl
Timeline for d1xoub_: