Lineage for d1xoub_ (1xou B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 546334Fold a.231: EspA/CesA-like [116926] (1 superfamily)
    4 helices; bundle, closed, left ight-handed twist; interlocked (hetero)dimer of 2-helical subunits
  4. 546335Superfamily a.231.1: EspA/CesA-like [116927] (2 families) (S)
    secreted protein and its chaperone both adopt similar substructures in the heterodimer
  5. 546340Family a.231.1.2: EspA chaperone CesA [116931] (1 protein)
  6. 546341Protein EspA chaperone CesA [116932] (1 species)
  7. 546342Species Escherichia coli [TaxId:562] [116933] (1 PDB entry)
  8. 546343Domain d1xoub_: 1xou B: [115716]
    Other proteins in same PDB: d1xoua_
    mutant

Details for d1xoub_

PDB Entry: 1xou (more details), 2.8 Å

PDB Description: Crystal structure of the CesA-EspA complex

SCOP Domain Sequences for d1xoub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xoub_ a.231.1.2 (B:) EspA chaperone CesA {Escherichia coli}
givsqtrnkelldkkirseieaikkiiaefdvvkesvnelsekaktdpqaaeklnklieg
ytygeerklydsalskieklietl

SCOP Domain Coordinates for d1xoub_:

Click to download the PDB-style file with coordinates for d1xoub_.
(The format of our PDB-style files is described here.)

Timeline for d1xoub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xoua_