Lineage for d1xoua_ (1xou A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651502Fold a.231: EspA/CesA-like [116926] (1 superfamily)
    4 helices; bundle, closed, left ight-handed twist; interlocked (hetero)dimer of 2-helical subunits
  4. 651503Superfamily a.231.1: EspA/CesA-like [116927] (2 families) (S)
    secreted protein and its chaperone both adopt similar substructures in the heterodimer
  5. 651504Family a.231.1.1: EspA-like [116928] (1 protein)
    Pfam PF03433
  6. 651505Protein Secreted protein EspA [116929] (1 species)
  7. 651506Species Escherichia coli [TaxId:562] [116930] (1 PDB entry)
  8. 651507Domain d1xoua_: 1xou A: [115715]
    Other proteins in same PDB: d1xoub_
    mutant

Details for d1xoua_

PDB Entry: 1xou (more details), 2.8 Å

PDB Description: crystal structure of the cesa-espa complex
PDB Compounds: (A:) EspA

SCOP Domain Sequences for d1xoua_:

Sequence, based on SEQRES records: (download)

>d1xoua_ a.231.1.1 (A:) Secreted protein EspA {Escherichia coli [TaxId: 562]}
dvidlfnklgvfqaailmfaymyqaqsdlsiakfadmneaskesttaqkmanlvdakiad
vqsssdknakaqlpdevisyindprnditisgidninaqlgagdlqtvkaaisakannlt
ttvnnsqleiqqmsntlnlltsarsdmqslqyrtisgisl

Sequence, based on observed residues (ATOM records): (download)

>d1xoua_ a.231.1.1 (A:) Secreted protein EspA {Escherichia coli [TaxId: 562]}
dvidlfnklgvfqaailmfaymyqaqsdlnltttvnnsqleiqqmsntlnlltsarsdmq
slqyrtisgisl

SCOP Domain Coordinates for d1xoua_:

Click to download the PDB-style file with coordinates for d1xoua_.
(The format of our PDB-style files is described here.)

Timeline for d1xoua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xoub_