Class a: All alpha proteins [46456] (258 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families) |
Family a.211.1.2: PDEase [48548] (6 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [48550] (14 PDB entries) |
Domain d1xota_: 1xot A: [115713] |
PDB Entry: 1xot (more details), 2.34 Å
SCOP Domain Sequences for d1xota_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xota_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]} edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv qpdaqdildtlednrnwyqsmip
Timeline for d1xota_: