Lineage for d1xoga_ (1xog A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2807607Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2807608Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2807621Protein Influenza neuraminidase [50943] (9 species)
  7. 2807670Species Influenza A virus, different strains [TaxId:11320] [50944] (89 PDB entries)
    Uniprot P03472 84-470
  8. 2807781Domain d1xoga_: 1xog A: [115701]
    complexed with abw, man, nag

Details for d1xoga_

PDB Entry: 1xog (more details), 2.8 Å

PDB Description: n9 tern influenza neuraminidase complexed with a 2,5-disubstituted tetrahydrofuran-5-carboxylic acid
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d1xoga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xoga_ b.68.1.1 (A:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
dfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttirg
khsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnna
saviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkegk
ilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicspv
ltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpna
ltddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwtsn
sivsmcssteflgqwdwpdgakieyfl

SCOPe Domain Coordinates for d1xoga_:

Click to download the PDB-style file with coordinates for d1xoga_.
(The format of our PDB-style files is described here.)

Timeline for d1xoga_: