Lineage for d1xoea_ (1xoe A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. Protein Influenza neuraminidase [50943] (9 species)
  7. Species Influenza A virus, different strains [TaxId:11320] [50944] (89 PDB entries)
    Uniprot P03472 84-470
  8. Domain d1xoea_: 1xoe A: [115700]
    complexed with abx, man, nag

Details for d1xoea_

PDB Entry: 1xoe (more details), 2.2 Å

PDB Description: n9 tern influenza neuraminidase complexed with (2r,4r,5r)-5-(1- acetylamino-3-methyl-butyl-pyrrolidine-2, 4-dicarobyxylic acid 4- methyl esterdase complexed with
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d1xoea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xoea_ b.68.1.1 (A:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
dfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttirg
khsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnna
saviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkegk
ilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicspv
ltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpna
ltddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwtsn
sivsmcssteflgqwdwpdgakieyfl

SCOPe Domain Coordinates for d1xoea_ are not available.

Timeline for d1xoea_: