Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.25: LEA14-like [117070] (1 family) |
Family b.1.25.1: LEA14-like [117071] (1 protein) Pfam PF03168 |
Protein Putative dessication related protein LEA14 [117072] (1 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117073] (1 PDB entry) Uniprot O03983 |
Domain d1xo8a_: 1xo8 A: [115698] Structural genomics target; At1g01470 |
PDB Entry: 1xo8 (more details)
SCOPe Domain Sequences for d1xo8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xo8a_ b.1.25.1 (A:) Putative dessication related protein LEA14 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} maslldkakdfvadkltaipkpegsvtdvdlkdvnrdsveylakvsvtnpyshsipicei sftfhsagreigkgkipdpgslkakdmtaldipvvvpysilfnlardvgvdwdidyelqi gltidlpvvgeftipisskgeiklptfkdff
Timeline for d1xo8a_: