Lineage for d1xo8a_ (1xo8 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766732Superfamily b.1.25: LEA14-like [117070] (1 family) (S)
  5. 2766733Family b.1.25.1: LEA14-like [117071] (1 protein)
    Pfam PF03168
  6. 2766734Protein Putative dessication related protein LEA14 [117072] (1 species)
  7. 2766735Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117073] (1 PDB entry)
    Uniprot O03983
  8. 2766736Domain d1xo8a_: 1xo8 A: [115698]
    Structural genomics target; At1g01470

Details for d1xo8a_

PDB Entry: 1xo8 (more details)

PDB Description: solution structure of at1g01470 from arabidopsis thaliana
PDB Compounds: (A:) At1g01470

SCOPe Domain Sequences for d1xo8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xo8a_ b.1.25.1 (A:) Putative dessication related protein LEA14 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
maslldkakdfvadkltaipkpegsvtdvdlkdvnrdsveylakvsvtnpyshsipicei
sftfhsagreigkgkipdpgslkakdmtaldipvvvpysilfnlardvgvdwdidyelqi
gltidlpvvgeftipisskgeiklptfkdff

SCOPe Domain Coordinates for d1xo8a_:

Click to download the PDB-style file with coordinates for d1xo8a_.
(The format of our PDB-style files is described here.)

Timeline for d1xo8a_: