SCOPe 2.06: Domain d1xo7b_: 1xo7 B:

Lineage for d1xo7b_ (1xo7 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein Cyclophilin (eukaryotic) [50893] (13 species)

7. Species Trypanosoma cruzi [TaxId:5693] [117269] (2 PDB entries)
   Uniprot Q4DPB9 30-194

8. Domain d1xo7b_: 1xo7 B: [115695]
   Structural genomics target

Details for d1xo7b_

PDB Entry: 1xo7, 1.61 Å

PDB Description: Crystal structure of cyclophilin from Trypanosoma cruzi

PDB Compounds: (B:) cyclophilin

SCOPe Domain Sequences for d1xo7b_:

Sequence; same for both SEQRES and ATOM records:

>d1xo7b_ b.62.1.1 (B:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]}
mpvvtdkvyfditigdepvgrvviglfgndvpktvenfkqlasgengfgykgsifhrvir
nfmiqggdftnfdgtggksiygtrfddenlkikhfvgavsmanagpnsngsqffvttapt
pwldgrhvvfgkvvegmdvvkkventktglndkpkkavkindcgvl

Timeline for d1xo7b_:

• d1xo7b_ first appeared in SCOP 1.71
  
• d1xo7b_ appears in SCOPe 2.05
  
• d1xo7b_ appears in SCOPe 2.07
  
• d1xo7b_ appears in the current release, SCOPe 2.08