Lineage for d1xo6e2 (1xo6 E:268-530)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1156478Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1156479Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1156986Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (6 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 1157065Protein Propionyl-CoA carboxylase complex B subunit, PccB [117466] (3 species)
  7. 1157079Species Streptomyces coelicolor [TaxId:1902] [117467] (4 PDB entries)
    Uniprot Q9X4K7
  8. 1157089Domain d1xo6e2: 1xo6 E:268-530 [115691]

Details for d1xo6e2

PDB Entry: 1xo6 (more details), 2.2 Å

PDB Description: Acyl-CoA Carboxylase Beta Subunit from S. coelicolor (PccB), apo form #3
PDB Compounds: (E:) propionyl-CoA carboxylase complex B subunit

SCOPe Domain Sequences for d1xo6e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xo6e2 c.14.1.4 (E:268-530) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]}
afpeeadlavtdedaeldtivpdsanqpydmhsviehvlddaeffetqplfapniltgfg
rvegrpvgivanqpmqfagclditasekaarfvrtcdafnvpvltfvdvpgflpgvdqeh
dgiirrgaklifayaeatvplitvitrkafggaydvmgskhlgadlnlawptaqiavmga
qgavnilhrrtiadagddaeatrarliqeyedallnpytaaergyvdavimpsdtrrhiv
rglrqlrtkreslppkkhgnipl

SCOPe Domain Coordinates for d1xo6e2:

Click to download the PDB-style file with coordinates for d1xo6e2.
(The format of our PDB-style files is described here.)

Timeline for d1xo6e2: