Lineage for d1xo6e1 (1xo6 E:10-267)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 577845Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 577846Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 578027Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (4 proteins)
    Pfam 01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 578098Protein Propionyl-CoA carboxylase complex B subunit, PccB [117466] (1 species)
  7. 578099Species Streptomyces coelicolor [TaxId:1902] [117467] (4 PDB entries)
  8. 578112Domain d1xo6e1: 1xo6 E:10-267 [115690]

Details for d1xo6e1

PDB Entry: 1xo6 (more details), 2.2 Å

PDB Description: Acyl-CoA Carboxylase Beta Subunit from S. coelicolor (PccB), apo form #3

SCOP Domain Sequences for d1xo6e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xo6e1 c.14.1.4 (E:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor}
dihttagkladlrrrieeathagsaravekqhakgkltareridllldegsfveldefar
hrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqkivkvmdfal
ktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpcaggavyspa
itdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhmagdekdave
yvkqllsylpsnnlsepp

SCOP Domain Coordinates for d1xo6e1:

Click to download the PDB-style file with coordinates for d1xo6e1.
(The format of our PDB-style files is described here.)

Timeline for d1xo6e1: