SCOPe 2.06: Domain d1xo5b_: 1xo5 B:

Lineage for d1xo5b_ (1xo5 B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calcium- and integrin-binding protein, CIB [47541] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47542] (3 PDB entries)
   Uniprot Q99828

8. Domain d1xo5b_: 1xo5 B: [115681]
   complexed with ca

Details for d1xo5b_

PDB Entry: 1xo5, 1.99 Å

PDB Description: crystal structure of cib1, an ef-hand, integrin and kinase-binding protein

PDB Compounds: (B:) Calcium and integrin-binding protein 1

SCOPe Domain Sequences for d1xo5b_:

Sequence, based on SEQRES records:

>d1xo5b_ a.39.1.5 (B:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]}
llaeyqdltfltkqeillahrrfcellpqeqrsvesslraqvpfeqilslpelkanpfke
ricrvfstspakdslsfedfldllsvfsdtatpdikshyafrifdfdddgtlnredlsrl
vncltgegedtrlsasemkqlidnileesdidrdgtinlsefqhvisrspdfassfkivl

Sequence, based on observed residues (ATOM records):

>d1xo5b_ a.39.1.5 (B:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]}
llaeyqdltfltkqeillahrrfcellpqeqrsvesslraqvpfeqilslpelkanpfke
ricrvfstspakdslsfedfldllsvfsdtatpdikshyafrifdfdddgtlnredlsrl
vnclasemkqlidnileesdidrdgtinlsefqhvisrspdfassfkivl

Timeline for d1xo5b_:

• d1xo5b_ first appeared in SCOP 1.71
  
• d1xo5b_ appears in SCOPe 2.05
  
• d1xo5b_ appears in SCOPe 2.07
  
• d1xo5b_ appears in the current release, SCOPe 2.08