Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calcium- and integrin-binding protein, CIB [47541] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47542] (3 PDB entries) Uniprot Q99828 |
Domain d1xo5a_: 1xo5 A: [115680] complexed with ca |
PDB Entry: 1xo5 (more details), 1.99 Å
SCOPe Domain Sequences for d1xo5a_:
Sequence, based on SEQRES records: (download)
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} llaeyqdltfltkqeillahrrfcellpqeqrsvesslraqvpfeqilslpelkanpfke ricrvfstspakdslsfedfldllsvfsdtatpdikshyafrifdfdddgtlnredlsrl vncltgegedtrlsasemkqlidnileesdidrdgtinlsefqhvisrspdfassfkivl
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} llaeyqdltfltkqeillahrrfcellpqeqrsvesslraqvpfeqilslpelkanpfke ricrvfstspakdslsfedfldllsvfsdtatpdikshyafrifdfdddgtlnredlsrl vncltrlsasemkqlidnileesdidrdgtinlsefqhvisrspdfassfkivl
Timeline for d1xo5a_: