Lineage for d1xo5a_ (1xo5 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 768456Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 768689Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 768710Protein Calcium- and integrin-binding protein, CIB [47541] (1 species)
  7. 768711Species Human (Homo sapiens) [TaxId:9606] [47542] (4 PDB entries)
    Uniprot Q99828
  8. 768712Domain d1xo5a_: 1xo5 A: [115680]

Details for d1xo5a_

PDB Entry: 1xo5 (more details), 1.99 Å

PDB Description: crystal structure of cib1, an ef-hand, integrin and kinase-binding protein
PDB Compounds: (A:) Calcium and integrin-binding protein 1

SCOP Domain Sequences for d1xo5a_:

Sequence, based on SEQRES records: (download)

>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]}
llaeyqdltfltkqeillahrrfcellpqeqrsvesslraqvpfeqilslpelkanpfke
ricrvfstspakdslsfedfldllsvfsdtatpdikshyafrifdfdddgtlnredlsrl
vncltgegedtrlsasemkqlidnileesdidrdgtinlsefqhvisrspdfassfkivl

Sequence, based on observed residues (ATOM records): (download)

>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]}
llaeyqdltfltkqeillahrrfcellpqeqrsvesslraqvpfeqilslpelkanpfke
ricrvfstspakdslsfedfldllsvfsdtatpdikshyafrifdfdddgtlnredlsrl
vncltrlsasemkqlidnileesdidrdgtinlsefqhvisrspdfassfkivl

SCOP Domain Coordinates for d1xo5a_:

Click to download the PDB-style file with coordinates for d1xo5a_.
(The format of our PDB-style files is described here.)

Timeline for d1xo5a_: